General Information

  • ID:  hor001526
  • Uniprot ID:  Q9XVX1
  • Protein name:  WANQVRF-amide
  • Gene name:  flp-19
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults. |Each flp gene is expressed in a distinct set of neurons. Flp-19 is expressed in the URX interneurons, the serotonin and acetylcholine-expressing HSN neurons, and th
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WANQVRF
  • Length:  7(70-76)
  • Propeptide:  MSFQLTLFSMLFLLIAVVVGQPIQSQNGDLKMQAVQDNSPLNMEAFNDDSALYDYLEQSDPSLKSMEKRWANQVRFGKRASWASSVRFG
  • Signal peptide:  MSFQLTLFSMLFLLIAVVVG
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the activity of dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XVX1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001526_AF2.pdbhor001526_ESM.pdb

Physical Information

Mass: 102724 Formula: C43H61N13O10
Absent amino acids: CDEGHIKLMPSTY Common amino acids: AFNQRVW
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -51.43 Boman Index: -1594
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 55.71
Instability Index: -3444.29 Extinction Coefficient cystines: 5500
Absorbance 280nm: 916.67

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry